PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g18130.6
Common NameLR48_Vigan01g318400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ZF-HD
Protein Properties Length: 198aa    MW: 22188.3 Da    PI: 9.0744
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g18130.6genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer85.55.6e-271491059
     ZF-HD_dimer 10 lkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                    lkNhAa++Gg+a+DGCgEfmps geegt++al+C+AC CHRnFHR+eve 
  Vang11g18130.6  1 LKNHAAAMGGNATDGCGEFMPS-GEEGTIEALNCSACHCHRNFHRKEVEG 49
                    69*******************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015668.3E-27147IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.2E-23147IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152323.71146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257747.0E-22158IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.604.6E-31117190IPR009057Homeodomain-like
SuperFamilySSF466898.16E-20121189IPR009057Homeodomain-like
TIGRFAMsTIGR015659.8E-28128184IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
LKNHAAAMGG NATDGCGEFM PSGEEGTIEA LNCSACHCHR NFHRKEVEGE PSSCDYHPFN  60
RRRLILGPHK NLLPPEALGY PTGNILPSRS VPPHQMIMPY SIGHLPSESD EQEDGGGMVQ  120
PRPSQLVKKR FRTKFTQEQK EKMLNFAERV GWKIQKQEES VVQQFCQEIG VKRRVLKVWM  180
HNNKHNLAKK NPPTAAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A6e-251271861675ZF-HD homeobox family protein